Cortactin Antikörper (N-Term)

Produktnummer ABIN631298

Produktdetails anti-Cortactin Antikörper

Target: Cortactin (CTTN)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cortactin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Cortactin antibody was raised against the N terminal of CTTN

Aufreinigung: Affinity purified

Immunogen: Cortactin antibody was raised using the N terminal of CTTN corresponding to a region with amino acids KHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cortactin Blocking Peptide, catalog no. 33R-4411, is also available for use as a blocking control in assays to test for specificity of this Cortactin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTTN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cortactin

Target: Cortactin (CTTN)

Andere Bezeichnung: Cortactin (CTTN Produkte)

Synonyme: EMS1 antikoerper, 1110020L01Rik antikoerper, Ems1 antikoerper, Cttnb antikoerper, CG3637 antikoerper, Dmel\CG3637 antikoerper, cortactin antikoerper, cttn antikoerper, CTTN1 antikoerper, P85.25 antikoerper, Cttn antikoerper, ems1 antikoerper, CTTN antikoerper, cortactin antikoerper, CG3637 gene product from transcript CG3637-RD antikoerper, cortactin S homeolog antikoerper, cortactin L homeolog antikoerper, src substrate cortactin antikoerper, Src substrate cortactin antikoerper, CTTN antikoerper, Cttn antikoerper, Cortactin antikoerper, cttn.S antikoerper, cttn.L antikoerper, cttn antikoerper, CpipJ_CPIJ006351 antikoerper, Bm1_57220 antikoerper, LOC100533277 antikoerper

Hintergrund: CTTN is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. CTTN is localized in the cytoplasm and in areas of the cell-substratum contacts. It has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells.

Molekulargewicht: 61 kDa (MW of target protein)

Pathways: MAPK Signalweg