KDM4B Antikörper (Middle Region)

Produktnummer ABIN631296

Produktdetails anti-KDM4B Antikörper

Target: KDM4B (Lysine (K)-Specific Demethylase 4B (KDM4B))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KDM4B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: JMJD2 B antibody was raised against the middle region of JMJD2

Aufreinigung: Affinity purified

Immunogen: JMJD2 B antibody was raised using the middle region of JMJD2 corresponding to a region with amino acids DQDRKWFETWDEEVVGTFSNWGFEDDGTDKDTNFHVALENVDTTMKVHIK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

JMJD2B Blocking Peptide, catalog no. 33R-2124, is also available for use as a blocking control in assays to test for specificity of this JMJD2B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JMJD0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KDM4B

Target: KDM4B (Lysine (K)-Specific Demethylase 4B (KDM4B))

Andere Bezeichnung: JMJD2B (KDM4B Produkte)

Synonyme: KDM4B antikoerper, JMJD2B antikoerper, jmjd2b antikoerper, si:ch211-124a3.4 antikoerper, TDRD14B antikoerper, 4732474L06Rik antikoerper, Jmjd2b antikoerper, mKIAA0876 antikoerper, lysine demethylase 4B antikoerper, lysine (K)-specific demethylase 4B antikoerper, KDM4B antikoerper, kdm4b antikoerper, Kdm4b antikoerper

Hintergrund: JMJD2 family proteins are classified into one group with JD2H and TUDOR domains and another group without JD2H or TUDOR domains. Because JMJD2C gene (also known as GASC1 gene) is amplified in esophageal squamous cell carcinoma (ESCC), JMJD2 family genes are cancer-associated genes.

Molekulargewicht: 122 kDa (MW of target protein)

Pathways: Warburg Effekt