KDM4B Antikörper (Middle Region)

Produktnummer ABIN631296

Dieses Anti-KDM4B-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von KDM4B in WB. Geeignet für Human.

Kurzübersicht für KDM4B Antikörper (Middle Region) (ABIN631296)

Target: KDM4B (Lysine (K)-Specific Demethylase 4B (KDM4B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KDM4B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KDM4B Antikörper

Bindungsspezifität: Middle Region

Spezifität: JMJD2 B antibody was raised against the middle region of JMJD2

Aufreinigung: Affinity purified

Immunogen: JMJD2 B antibody was raised using the middle region of JMJD2 corresponding to a region with amino acids DQDRKWFETWDEEVVGTFSNWGFEDDGTDKDTNFHVALENVDTTMKVHIK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

JMJD2B Blocking Peptide, (ABIN937510), is also available for use as a blocking control in assays to test for specificity of this JMJD2B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JMJD0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KDM4B

Target: KDM4B (Lysine (K)-Specific Demethylase 4B (KDM4B))

Andere Bezeichnung: JMJD2B

Hintergrund: JMJD2 family proteins are classified into one group with JD2H and TUDOR domains and another group without JD2H or TUDOR domains. Because JMJD2C gene (also known as GASC1 gene) is amplified in esophageal squamous cell carcinoma (ESCC), JMJD2 family genes are cancer-associated genes.

Molekulargewicht: 122 kDa (MW of target protein)

Pathways: Warburg Effekt