PRTFDC1 Antikörper (Middle Region)

Produktnummer ABIN631291

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch PRTFDC1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für PRTFDC1 Antikörper (Middle Region) (ABIN631291)

Target: PRTFDC1 (phosphoribosyl Transferase Domain Containing 1 (PRTFDC1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRTFDC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PRTFDC1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PRTFDC1 antibody was raised against the middle region of PRTFDC1

Aufreinigung: Affinity purified

Immunogen: PRTFDC1 antibody was raised using the middle region of PRTFDC1 corresponding to a region with amino acids MKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYA

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRTFDC1 Blocking Peptide, (ABIN5615606), is also available for use as a blocking control in assays to test for specificity of this PRTFDC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRTFDC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRTFDC1

Target: PRTFDC1 (phosphoribosyl Transferase Domain Containing 1 (PRTFDC1))

Andere Bezeichnung: PRTFDC1

Hintergrund: PRTFDC1 belongs to the purine/pyrimidine phosphoribosyltransferase family. Epigenetic silencing of PRTFDC1 by hypermethylation of the CpG islands leads to a loss of PRTFDC1 function, which might be involved in squamous cell oral carcinogenesis.

Molekulargewicht: 26 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process