PRTFDC1 Antikörper (Middle Region)
-
- Target Alle PRTFDC1 Antikörper anzeigen
- PRTFDC1 (phosphoribosyl Transferase Domain Containing 1 (PRTFDC1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PRTFDC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PRTFDC1 antibody was raised against the middle region of PRTFDC1
- Aufreinigung
- Affinity purified
- Immunogen
- PRTFDC1 antibody was raised using the middle region of PRTFDC1 corresponding to a region with amino acids MKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYA
- Top Product
- Discover our top product PRTFDC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRTFDC1 Blocking Peptide, catalog no. 33R-6122, is also available for use as a blocking control in assays to test for specificity of this PRTFDC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRTFDC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRTFDC1 (phosphoribosyl Transferase Domain Containing 1 (PRTFDC1))
- Andere Bezeichnung
- PRTFDC1 (PRTFDC1 Produkte)
- Hintergrund
- PRTFDC1 belongs to the purine/pyrimidine phosphoribosyltransferase family. Epigenetic silencing of PRTFDC1 by hypermethylation of the CpG islands leads to a loss of PRTFDC1 function, which might be involved in squamous cell oral carcinogenesis.
- Molekulargewicht
- 26 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-