NARG1L Antikörper (Middle Region)

Produktnummer ABIN631267

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch NARG1L in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für NARG1L Antikörper (Middle Region) (ABIN631267)

Target: NARG1L (NAA16) (N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NARG1L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NARG1L Antikörper

Bindungsspezifität: Middle Region

Spezifität: NARG1 L antibody was raised against the middle region of NARG1

Aufreinigung: Affinity purified

Immunogen: NARG1 L antibody was raised using the middle region of NARG1 corresponding to a region with amino acids RKGKFLLMLQSVKRAFAINSNNPWLHECLIRFSKSVSNHSNLPDIVSKVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NARG1L Blocking Peptide, (ABIN5614918), is also available for use as a blocking control in assays to test for specificity of this NARG1L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NARG0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NARG1L

Target: NARG1L (NAA16) (N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16))

Andere Bezeichnung: NARG1L

Hintergrund: NARG1L may belong to a complex displaying N-terminal acetyltransferase activity.

Molekulargewicht: 101 kDa (MW of target protein)