NARG1L Antikörper (Middle Region)

Produktnummer ABIN630806

Produktdetails anti-NARG1L Antikörper

Target: NARG1L (NAA16) (N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NARG1L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: NARG1 L antibody was raised against the middle region of NARG1

Aufreinigung: Affinity purified

Immunogen: NARG1 L antibody was raised using the middle region of NARG1 corresponding to a region with amino acids ASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFDKLGQYSLALDYINAA

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NARG1L Blocking Peptide, catalog no. 33R-1516, is also available for use as a blocking control in assays to test for specificity of this NARG1L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NARG0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NARG1L

Target: NARG1L (NAA16) (N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16))

Andere Bezeichnung: NARG1L (NAA16 Produkte)

Synonyme: NARG1L antikoerper, 1300019C06Rik antikoerper, Narg1l antikoerper, narg1 antikoerper, narg1l antikoerper, N(alpha)-acetyltransferase 16, NatA auxiliary subunit antikoerper, N(alpha)-acetyltransferase 16, NatA auxiliary subunit L homeolog antikoerper, N(alpha)-acetyltransferase 15, NatA auxiliary subunit S homeolog antikoerper, NAA16 antikoerper, Naa16 antikoerper, naa16.L antikoerper, naa15.S antikoerper

Hintergrund: NARG1L may belong to a complex displaying N-terminal acetyltransferase activity.

Molekulargewicht: 50 kDa (MW of target protein)