PFAS Antikörper

Produktnummer ABIN631263

Produktdetails anti-PFAS Antikörper

Target: PFAS (Phosphoribosylformylglycinamidine Synthase (PFAS))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PFAS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PFAS antibody was raised using a synthetic peptide corresponding to a region with amino acids ESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQGL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PFAS Blocking Peptide, catalog no. 33R-2731, is also available for use as a blocking control in assays to test for specificity of this PFAS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFAS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PFAS

Target: PFAS (Phosphoribosylformylglycinamidine Synthase (PFAS))

Andere Bezeichnung: PFAS (PFAS Produkte)

Synonyme: FGAMS antikoerper, FGARAT antikoerper, PURL antikoerper, 4432409B16Rik antikoerper, Gm18 antikoerper, Sofa antikoerper, phosphoribosylformylglycinamidine synthase antikoerper, phosphoribosylformylglycinamidine synthase (FGAR amidotransferase) antikoerper, Spirs_3128 antikoerper, PFAS antikoerper, Pfas antikoerper

Hintergrund: Purines are necessary for many cellular processes, including DNA replication, transcription, and energy metabolism. Ten enzymatic steps are required to synthesize inosine monophosphate (IMP) in the de novo pathway of purine biosynthesis. PFAS catalyzes the fourth step of IMP biosynthesis.

Molekulargewicht: 145 kDa (MW of target protein)