Aurora Kinase C Antikörper (Middle Region)

Produktnummer ABIN631252

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Aurora Kinase C in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für Aurora Kinase C Antikörper (Middle Region) (ABIN631252)

Target: Aurora Kinase C (AURKC)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Aurora Kinase C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Aurora Kinase C Antikörper

Bindungsspezifität: Middle Region

Spezifität: AURKC antibody was raised against the middle region of AURKC

Aufreinigung: Affinity purified

Immunogen: AURKC antibody was raised using the middle region of AURKC corresponding to a region with amino acids TYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AURKC Blocking Peptide, (ABIN5612246), is also available for use as a blocking control in assays to test for specificity of this AURKC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AURKC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Aurora Kinase C

Target: Aurora Kinase C (AURKC)

Andere Bezeichnung: AURKC

Hintergrund: AURKC may play a part in organizing microtubules in relation to the function of the centrosome/spindle pole during mitosis.

Molekulargewicht: 34 kDa (MW of target protein)

Pathways: Zellzyklus, Maintenance of Protein Location