WASF3 Antikörper (N-Term)

Produktnummer ABIN631248

Dieses Anti-WASF3-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von WASF3 in WB. Geeignet für Human.

Kurzübersicht für WASF3 Antikörper (N-Term) (ABIN631248)

Target: WASF3 (WAS Protein Family, Member 3 (WASF3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WASF3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-WASF3 Antikörper

Bindungsspezifität: N-Term

Spezifität: WASF3 antibody was raised against the N terminal of WASF3

Aufreinigung: Affinity purified

Immunogen: WASF3 antibody was raised using the N terminal of WASF3 corresponding to a region with amino acids NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WASF3 Blocking Peptide, (ABIN5616988), is also available for use as a blocking control in assays to test for specificity of this WASF3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WASF3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WASF3

Target: WASF3 (WAS Protein Family, Member 3 (WASF3))

Andere Bezeichnung: WASF3

Hintergrund: WASF3 is a member of the Wiskott-Aldrich syndrome protein family. It is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function.

Molekulargewicht: 55 kDa (MW of target protein)

Pathways: RTK Signalweg