Ketohexokinase Antikörper

Produktnummer ABIN631217

Produktdetails anti-Ketohexokinase Antikörper

Target: Ketohexokinase (KHK)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Ketohexokinase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Affinity purified

Immunogen: KHK antibody was raised using a synthetic peptide corresponding to a region with amino acids FQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KHK Blocking Peptide, catalog no. 33R-3036, is also available for use as a blocking control in assays to test for specificity of this KHK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Ketohexokinase

Target: Ketohexokinase (KHK)

Andere Bezeichnung: KHK (KHK Produkte)

Synonyme: wu:fj68h03 antikoerper, zgc:92219 antikoerper, zgc:92626 antikoerper, KHK antikoerper, khk antikoerper, KETHPRO antikoerper, ketohexokinase antikoerper, Ketohexokinase antikoerper, KHK antikoerper, khk antikoerper, Hhal_0921 antikoerper, AaeL_AAEL006316 antikoerper, Nwat_0240 antikoerper, Khk antikoerper

Hintergrund: KHK is a ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose.KHK encodes the gene ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The splice variant presented encodes the highly active form found in liver, renal cortex, and small intestine, while the alternate variant encodes the lower activity form found in most other tissues.

Molekulargewicht: 33 kDa (MW of target protein)