PFN1 Antikörper (N-Term)

Produktnummer ABIN631215

Produktdetails anti-PFN1 Antikörper

Target: PFN1 (Profilin 1 (PFN1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PFN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Profilin 1 antibody was raised against the N terminal of PFN1

Aufreinigung: Affinity purified

Immunogen: Profilin 1 antibody was raised using the N terminal of PFN1 corresponding to a region with amino acids AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Profilin 1 Blocking Peptide, catalog no. 33R-1234, is also available for use as a blocking control in assays to test for specificity of this Profilin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PFN1

Target: PFN1 (Profilin 1 (PFN1))

Andere Bezeichnung: Profilin 1 (PFN1 Produkte)

Synonyme: GmPRO1 antikoerper, GmPRO2 antikoerper, PRO1 antikoerper, Profilin-1 antikoerper, profilin-1 antikoerper, profilin antikoerper, MGC130883 antikoerper, Profilin1 antikoerper, XProfilin1 antikoerper, sb:cb813 antikoerper, wu:fa91a03 antikoerper, ALS18 antikoerper, Pfn antikoerper, F6F22.21 antikoerper, F6F22_21 antikoerper, PFN1 antikoerper, PROFILIN 1 antikoerper, profilin 1 antikoerper, profilin antikoerper, profilin 1 antikoerper, profilin 1 L homeolog antikoerper, profilin homolog 1 antikoerper, Profilin-1 antikoerper, PRO2 antikoerper, PFN1 antikoerper, pfn1.L antikoerper, pfn1 antikoerper, Pfn1 antikoerper, PRF1 antikoerper, prf1 antikoerper, pfn-1 antikoerper

Hintergrund: PFN1 is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome.

Molekulargewicht: 15 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization, Tube Formation, Maintenance of Protein Location