PFN1 Antikörper (N-Term)

Produktnummer ABIN631215

Dieses Anti-PFN1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PFN1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für PFN1 Antikörper (N-Term) (ABIN631215)

Target: PFN1 (Profilin 1 (PFN1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PFN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PFN1 Antikörper

Bindungsspezifität: N-Term

Spezifität: Profilin 1 antibody was raised against the N terminal of PFN1

Aufreinigung: Affinity purified

Immunogen: Profilin 1 antibody was raised using the N terminal of PFN1 corresponding to a region with amino acids AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Profilin 1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this Profilin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PFN1

Target: PFN1 (Profilin 1 (PFN1))

Andere Bezeichnung: Profilin 1

Hintergrund: PFN1 is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome.

Molekulargewicht: 15 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization, Tube Formation, Maintenance of Protein Location