COTL1 Antikörper

Produktnummer ABIN631212

Produktdetails anti-COTL1 Antikörper

Target: COTL1 (Coactosin-Like Protein)

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser COTL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Coactosin-Like 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Coactosin-Like 1 Blocking Peptide, catalog no. 33R-5779, is also available for use as a blocking control in assays to test for specificity of this Coactosin-Like 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COTL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu COTL1

Target: COTL1 (Coactosin-Like Protein)

Andere Bezeichnung: Coactosin-Like 1 (COTL1 Produkte)

Synonyme: CLP antikoerper, 1810074P22Rik antikoerper, 2010004C08Rik antikoerper, Clp antikoerper, coactosin like F-actin binding protein 1 antikoerper, coactosin-like 1 (Dictyostelium) antikoerper, coactosin-like F-actin binding protein 1 antikoerper, COTL1 antikoerper, Cotl1 antikoerper

Hintergrund: This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis.

Molekulargewicht: 16 kDa (MW of target protein)