COTL1 Antikörper

Produktnummer ABIN631212

Der Kaninchen Polyklonal anti-COTL1 Antikörper (ABIN631212) detektiert spezifisch COTL1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human und Maus.

Kurzübersicht für COTL1 Antikörper (ABIN631212)

Target: COTL1 (Coactosin-Like Protein)

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser COTL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-COTL1 Antikörper

Aufreinigung: Affinity purified

Immunogen: Coactosin-Like 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Coactosin-Like 1 Blocking Peptide, (ABIN5612944), is also available for use as a blocking control in assays to test for specificity of this Coactosin-Like 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COTL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu COTL1

Target: COTL1 (Coactosin-Like Protein)

Andere Bezeichnung: Coactosin-Like 1

Hintergrund: This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis.

Molekulargewicht: 16 kDa (MW of target protein)