UBR1 Antikörper (N-Term)

Produktnummer ABIN631210

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch UBR1 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für UBR1 Antikörper (N-Term) (ABIN631210)

Target: UBR1 (Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UBR1 Antikörper

Bindungsspezifität: N-Term

Spezifität: UBR1 antibody was raised against the N terminal of UBR1

Aufreinigung: Affinity purified

Immunogen: UBR1 antibody was raised using the N terminal of UBR1 corresponding to a region with amino acids YKQLQKEYISDDHDRSISITALSVQMFTVPTLARHLIEEQNVISVITETL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBR1 Blocking Peptide, (ABIN936122), is also available for use as a blocking control in assays to test for specificity of this UBR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBR1

Target: UBR1 (Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1))

Andere Bezeichnung: UBR1

Hintergrund: UBR1 is an E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. recognises and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.

Molekulargewicht: 200 kDa (MW of target protein)