AMD1 Antikörper (N-Term)

Produktnummer ABIN631207

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch AMD1 in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für AMD1 Antikörper (N-Term) (ABIN631207)

Target: AMD1 (Adenosylmethionine Decarboxylase 1 (AMD1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AMD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AMD1 Antikörper

Bindungsspezifität: N-Term

Spezifität: AMD1 antibody was raised against the N terminal of AMD1

Aufreinigung: Affinity purified

Immunogen: AMD1 antibody was raised using the N terminal of AMD1 corresponding to a region with amino acids MGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AMD1 Blocking Peptide, (ABIN5612044), is also available for use as a blocking control in assays to test for specificity of this AMD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AMD1

Target: AMD1 (Adenosylmethionine Decarboxylase 1 (AMD1))

Andere Bezeichnung: AMD1

Hintergrund: The specific function of AMD1 is not yet known.

Molekulargewicht: 21 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process