OPTN Antikörper (C-Term)

Produktnummer ABIN631194

Produktdetails anti-OPTN Antikörper

Target: OPTN (Optineurin (OPTN))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OPTN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Optineurin antibody was raised against the C terminal of OPTN

Aufreinigung: Affinity purified

Immunogen: Optineurin antibody was raised using the C terminal of OPTN corresponding to a region with amino acids SDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Optineurin Blocking Peptide, catalog no. 33R-8367, is also available for use as a blocking control in assays to test for specificity of this Optineurin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OPTN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OPTN

Target: OPTN (Optineurin (OPTN))

Andere Bezeichnung: Optineurin (OPTN Produkte)

Synonyme: nrp antikoerper, fip2 antikoerper, hip7 antikoerper, hypl antikoerper, glc1e antikoerper, tfiiia-intp antikoerper, ALS12 antikoerper, FIP2 antikoerper, GLC1E antikoerper, HIP7 antikoerper, HYPL antikoerper, NRP antikoerper, TFIIIA-INTP antikoerper, Fip2 antikoerper, 4930441O07Rik antikoerper, fj52f04 antikoerper, si:ch211-240l19.3 antikoerper, wu:fj52f04 antikoerper, zgc:66386 antikoerper, zgc:77868 antikoerper, optineurin antikoerper, optineurin L homeolog antikoerper, OPTN antikoerper, optn antikoerper, Optn antikoerper, optn.L antikoerper

Hintergrund: OPTN is the coiled-coil containing protein optineurin. Optineurin may play a role in normal-tension glaucoma and adult-onset primary open angle glaucoma. Optineurin interacts with adenovirus E3-14.7K protein and may utilize tumor necrosis factor-alpha or Fas-ligand pathways to mediate apoptosis, inflammation or vasoconstriction. Optineurin may also function in cellular morphogenesis and membrane trafficking, vesicle trafficking, and transcription activation through its interactions with the RAB8, huntingtin, and transcription factor IIIA proteins.

Molekulargewicht: 66 kDa (MW of target protein)

Pathways: M Phase