OPTN Antikörper (C-Term)

Produktnummer ABIN631194

Dieses Anti-OPTN-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von OPTN in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für OPTN Antikörper (C-Term) (ABIN631194)

Target: OPTN (Optineurin (OPTN))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OPTN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-OPTN Antikörper

Bindungsspezifität: C-Term

Spezifität: Optineurin antibody was raised against the C terminal of OPTN

Aufreinigung: Affinity purified

Immunogen: Optineurin antibody was raised using the C terminal of OPTN corresponding to a region with amino acids SDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Optineurin Blocking Peptide, (ABIN5615129), is also available for use as a blocking control in assays to test for specificity of this Optineurin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OPTN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OPTN

Target: OPTN (Optineurin (OPTN))

Andere Bezeichnung: Optineurin

Hintergrund: OPTN is the coiled-coil containing protein optineurin. Optineurin may play a role in normal-tension glaucoma and adult-onset primary open angle glaucoma. Optineurin interacts with adenovirus E3-14.7K protein and may utilize tumor necrosis factor-alpha or Fas-ligand pathways to mediate apoptosis, inflammation or vasoconstriction. Optineurin may also function in cellular morphogenesis and membrane trafficking, vesicle trafficking, and transcription activation through its interactions with the RAB8, huntingtin, and transcription factor IIIA proteins.

Molekulargewicht: 66 kDa (MW of target protein)

Pathways: M Phase