TINF2 Antikörper

Produktnummer ABIN631193

Der Kaninchen Polyklonal anti-TINF2 Antikörper wird verwendet zum Nachweis von TINF2 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für TINF2 Antikörper (ABIN631193)

Target: TINF2 (TIN2) (TERF1 Interacting Nuclear Factor 2 (TIN2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TINF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TINF2 Antikörper

Aufreinigung: Affinity purified

Immunogen: TINF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SDEEENGQGEGKESLENYQKTKFDTLIPTLCEYLPPSGHGAIPVSSCDCR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TINF2 Blocking Peptide, (ABIN5616612), is also available for use as a blocking control in assays to test for specificity of this TINF2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TINF2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TINF2

Target: TINF2 (TIN2) (TERF1 Interacting Nuclear Factor 2 (TIN2))

Andere Bezeichnung: TINF2

Hintergrund: TINF2 is a component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends, without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. It plays a role in shelterin complex assembly.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: Zellzyklus, Telomere Maintenance, Regulation of Carbohydrate Metabolic Process