CLECL1 Antikörper (N-Term)

Produktnummer ABIN631187

Produktdetails anti-CLECL1 Antikörper

Target: CLECL1 (C-Type Lectin-Like 1 (CLECL1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLECL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CLECL1 antibody was raised against the N terminal of CLECL1

Aufreinigung: Affinity purified

Immunogen: CLECL1 antibody was raised using the N terminal of CLECL1 corresponding to a region with amino acids MVSNFFHVIQVFEKSATLISKTEHIGFVIYSWRKSTTHLGSRRKFAISIY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CLECL1 Blocking Peptide, catalog no. 33R-6608, is also available for use as a blocking control in assays to test for specificity of this CLECL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLECL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLECL1

Target: CLECL1 (C-Type Lectin-Like 1 (CLECL1))

Andere Bezeichnung: CLECL1 (CLECL1 Produkte)

Synonyme: DCAL-1 antikoerper, DCAL1 antikoerper, C-type lectin like 1 antikoerper, CLECL1 antikoerper

Hintergrund: DCAL1 is a type II transmembrane, C-type lectin-like protein expressed on dendritic cells (DCs) and B cells. It interacts with subsets of T cells as a costimulatory molecule that enhances interleukin-4 production.

Molekulargewicht: 19 kDa (MW of target protein)