SULT2B1 Antikörper (N-Term)

Produktnummer ABIN631181

Der Kaninchen Polyklonal Anti-SULT2B1 Antikörper wurde für WB validiert. Er ist geeignet, SULT2B1 in Proben von Human zu detektieren.

Kurzübersicht für SULT2B1 Antikörper (N-Term) (ABIN631181)

Target: SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1 (SULT2B1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SULT2B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SULT2B1 Antikörper

Bindungsspezifität: N-Term

Spezifität: SULT2 B1 antibody was raised against the N terminal of SULT2 1

Aufreinigung: Affinity purified

Immunogen: SULT2 B1 antibody was raised using the N terminal of SULT2 1 corresponding to a region with amino acids MASPPPFHSQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SULT2B1 Blocking Peptide, (ABIN5616456), is also available for use as a blocking control in assays to test for specificity of this SULT2B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SULT2B1

Target: SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1 (SULT2B1))

Andere Bezeichnung: SULT2B1

Hintergrund: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis