GLUD1 Antikörper (N-Term)

Produktnummer ABIN631169

Der Kaninchen Polyklonal Anti-GLUD1-Antikörper wurde für WB validiert. Er ist geeignet, GLUD1 in Proben von Human zu detektieren.

Kurzübersicht für GLUD1 Antikörper (N-Term) (ABIN631169)

Target: GLUD1 (Glutamate Dehydrogenase 1 (GLUD1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GLUD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GLUD1 Antikörper

Bindungsspezifität: N-Term

Spezifität: GLUD1 antibody was raised against the N terminal of GLUD1

Aufreinigung: Affinity purified

Immunogen: GLUD1 antibody was raised using the N terminal of GLUD1 corresponding to a region with amino acids EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GLUD1 Blocking Peptide, (ABIN937813), is also available for use as a blocking control in assays to test for specificity of this GLUD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLUD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GLUD1

Target: GLUD1 (Glutamate Dehydrogenase 1 (GLUD1))

Andere Bezeichnung: GLUD1

Hintergrund: L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate. Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Warburg Effekt