MTPN Antikörper (Middle Region)

Produktnummer ABIN631163

Der Kaninchen Polyklonal Anti-MTPN-Antikörper wurde für WB validiert. Er ist geeignet, MTPN in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für MTPN Antikörper (Middle Region) (ABIN631163)

Target: MTPN (Myotrophin (MTPN))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MTPN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MTPN Antikörper

Bindungsspezifität: Middle Region

Spezifität: Myotrophin antibody was raised against the middle region of MTPN

Aufreinigung: Affinity purified

Immunogen: Myotrophin antibody was raised using the middle region of MTPN corresponding to a region with amino acids GRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Myotrophin Blocking Peptide, (ABIN938920), is also available for use as a blocking control in assays to test for specificity of this Myotrophin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTPN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MTPN

Target: MTPN (Myotrophin (MTPN))

Andere Bezeichnung: Myotrophin

Hintergrund: MTPN has a potential role in cerebellar morphogenesis. MTPN may function in differentiation of cerebellar neurons, particularly of granule cells. MTPN seems to be associated with cardiac hypertrophy.

Molekulargewicht: 13 kDa (MW of target protein)