PADI2 Antikörper (Middle Region)
-
- Target Alle PADI2 Antikörper anzeigen
- PADI2 (Peptidyl Arginine Deiminase, Type II (PADI2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PADI2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PADI2 antibody was raised against the middle region of PADI2
- Aufreinigung
- Affinity purified
- Immunogen
- PADI2 antibody was raised using the middle region of PADI2 corresponding to a region with amino acids RGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYV
- Top Product
- Discover our top product PADI2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PADI2 Blocking Peptide, catalog no. 33R-7920, is also available for use as a blocking control in assays to test for specificity of this PADI2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PADI2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PADI2 (Peptidyl Arginine Deiminase, Type II (PADI2))
- Andere Bezeichnung
- PADI2 (PADI2 Produkte)
- Hintergrund
- PADI2 encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. PADI2 is thought to play a role in the onset and progression of neurodegenerative human disorders, including Alzheimer disease and multiple sclerosis, and it has also been implicated in glaucoma pathogenesis.
- Molekulargewicht
- 75 kDa (MW of target protein)
-