Epsin 2 Antikörper (Middle Region)
-
- Target Alle Epsin 2 (EPN2) Antikörper anzeigen
- Epsin 2 (EPN2)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Epsin 2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Epsin 2 antibody was raised against the middle region of EPN2
- Aufreinigung
- Affinity purified
- Immunogen
- Epsin 2 antibody was raised using the middle region of EPN2 corresponding to a region with amino acids DPFESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLN
- Top Product
- Discover our top product EPN2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Epsin 2 Blocking Peptide, catalog no. 33R-2101, is also available for use as a blocking control in assays to test for specificity of this Epsin 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPN2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Epsin 2 (EPN2)
- Andere Bezeichnung
- Epsin 2 (EPN2 Produkte)
- Synonyme
- CG13853 antikoerper, CG13854 antikoerper, CG31170 antikoerper, CG31285 antikoerper, CG42250 antikoerper, Dmel\\CG42250 antikoerper, Dmel_CG31170 antikoerper, Dmel_CG31285 antikoerper, Epsin antikoerper, LqfR antikoerper, XII-10 antikoerper, epsin antikoerper, epsin-like antikoerper, epsin02 antikoerper, epsinR antikoerper, l(3)03685 antikoerper, l(3)A9 antikoerper, l(3)SG62 antikoerper, l(3)XII-10 antikoerper, l(3)dsl-9 antikoerper, l(3)dsl9 antikoerper, EHB21 antikoerper, 9530051D10Rik antikoerper, AA536924 antikoerper, Ibp2 antikoerper, epsin-2 antikoerper, liquid facets-Related antikoerper, epsin 2 antikoerper, epsin-2 antikoerper, Epsin 2 antikoerper, epsin 2 S homeolog antikoerper, lqfR antikoerper, EPN2 antikoerper, EDI_326810 antikoerper, EDI_044850 antikoerper, Bm1_38210 antikoerper, EHI_104950 antikoerper, epn2 antikoerper, Epn2 antikoerper, epn2.S antikoerper
- Hintergrund
- EPN2 is a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis.
- Molekulargewicht
- 62 kDa (MW of target protein)
- Pathways
- EGFR Downregulation
-