Epsin 2 Antikörper (Middle Region)

Produktnummer ABIN631154

Der Kaninchen Polyklonal Anti-Epsin 2-Antikörper wurde für WB validiert. Er ist geeignet, Epsin 2 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für Epsin 2 Antikörper (Middle Region) (ABIN631154)

Target: Epsin 2 (EPN2)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Epsin 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Epsin 2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Epsin 2 antibody was raised against the middle region of EPN2

Aufreinigung: Affinity purified

Immunogen: Epsin 2 antibody was raised using the middle region of EPN2 corresponding to a region with amino acids DPFESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Epsin 2 Blocking Peptide, (ABIN937487), is also available for use as a blocking control in assays to test for specificity of this Epsin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Epsin 2

Target: Epsin 2 (EPN2)

Andere Bezeichnung: Epsin 2

Hintergrund: EPN2 is a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis.

Molekulargewicht: 62 kDa (MW of target protein)

Pathways: EGFR Downregulation