BRAP Antikörper (Middle Region)

Produktnummer ABIN631144

Produktdetails anti-BRAP Antikörper

Target: BRAP (BRCA1 Associated Protein (BRAP))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BRAP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BRAP antibody was raised against the middle region of BRAP

Aufreinigung: Affinity purified

Immunogen: BRAP antibody was raised using the middle region of BRAP corresponding to a region with amino acids YLETQQKINHLPAETRQEIQEGQINIAMASASSPASSGGSGKLPSRKGRS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BRAP Blocking Peptide, catalog no. 33R-10166, is also available for use as a blocking control in assays to test for specificity of this BRAP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRAP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BRAP

Target: BRAP (BRCA1 Associated Protein (BRAP))

Andere Bezeichnung: BRAP (BRAP Produkte)

Synonyme: imp antikoerper, MGC68778 antikoerper, zgc:92894 antikoerper, BRAP antikoerper, BRAP2 antikoerper, IMP antikoerper, RNF52 antikoerper, 3010002G07Rik antikoerper, BRCA1 associated protein S homeolog antikoerper, BRCA1 associated protein antikoerper, BRCA1-associated protein antikoerper, brca1-associated protein antikoerper, brap.S antikoerper, brap antikoerper, BRAP antikoerper, NAEGRDRAFT_81654 antikoerper, CC1G_00971 antikoerper, CpipJ_CPIJ003557 antikoerper, Tsp_05101 antikoerper, LOC100282389 antikoerper, Brap antikoerper

Hintergrund: The protein encoded by this gene was identified by its ability to bind to the nuclear localization signal of BRCA1 and other proteins. It is a cytoplasmic protein which may regulate nuclear targeting by retaining proteins with a nuclear localization signal in the cytoplasm.

Molekulargewicht: 67 kDa (MW of target protein)