Adipsin Antikörper (N-Term)

Produktnummer ABIN631122

Produktdetails anti-Adipsin Antikörper

Target: Adipsin (CFD) (Complement Factor D (CFD))

Bindungsspezifität: N-Term

Reaktivität: Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Adipsin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EVE antibody was raised against the N terminal Of Eve

Aufreinigung: Affinity purified

Immunogen: EVE antibody was raised using the N terminal Of Eve corresponding to a region with amino acids MHGYRTYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLS

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EVE Blocking Peptide, catalog no. 33R-6092, is also available for use as a blocking control in assays to test for specificity of this EVE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EVE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Adipsin

Target: Adipsin (CFD) (Complement Factor D (CFD))

Andere Bezeichnung: EVE (CFD Produkte)

Synonyme: ADIPSIN antikoerper, ADN antikoerper, DF antikoerper, PFD antikoerper, Adn antikoerper, Df antikoerper, EVE antikoerper, CFD antikoerper, adipsin antikoerper, pfd antikoerper, cfdl antikoerper, wu:fb61f12 antikoerper, zgc:109940 antikoerper, 10.5 antikoerper, 10.9 antikoerper, 14.10 antikoerper, 20.35 antikoerper, CG2328 antikoerper, Dmel\\CG2328 antikoerper, E(eve) antikoerper, Eve antikoerper, F antikoerper, V antikoerper, VI antikoerper, eve2 antikoerper, even antikoerper, l(2)46CFg antikoerper, l(2)46CFh antikoerper, l(2)46CFj antikoerper, l(2)46CFp antikoerper, l(2)46Ce antikoerper, l(2)46Cg antikoerper, complement factor D antikoerper, complement factor D (adipsin) antikoerper, complement factor D (adipsin) L homeolog antikoerper, even skipped antikoerper, CFD antikoerper, Cfd antikoerper, cfd.L antikoerper, cfd antikoerper, eve antikoerper

Hintergrund: Eve may play a role in determining neuronal identity. It may be directly involved in specifying identity of individual neurons. It is a pair-rule protein required for segmentation, involved in transforming the broad, spatial, aperiodic expression patterns of the gap genes into a system of precise periodic expression patterns of the pair-rule and segmentary polarity genes.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Komplementsystem