Adipsin Antikörper (N-Term)

Produktnummer ABIN631122

Dieses Anti-Adipsin-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Adipsin in WB. Geeignet für Drosophila melanogaster.

Kurzübersicht für Adipsin Antikörper (N-Term) (ABIN631122)

Target: Adipsin (CFD) (Complement Factor D (CFD))

Reaktivität: Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Adipsin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Adipsin Antikörper

Bindungsspezifität: N-Term

Spezifität: EVE antibody was raised against the N terminal Of Eve

Aufreinigung: Affinity purified

Immunogen: EVE antibody was raised using the N terminal Of Eve corresponding to a region with amino acids MHGYRTYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLS

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EVE Blocking Peptide, (ABIN5613417), is also available for use as a blocking control in assays to test for specificity of this EVE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EVE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Adipsin

Target: Adipsin (CFD) (Complement Factor D (CFD))

Andere Bezeichnung: EVE

Hintergrund: Eve may play a role in determining neuronal identity. It may be directly involved in specifying identity of individual neurons. It is a pair-rule protein required for segmentation, involved in transforming the broad, spatial, aperiodic expression patterns of the gap genes into a system of precise periodic expression patterns of the pair-rule and segmentary polarity genes.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Komplementsystem