Lactate Dehydrogenase C Antikörper (Middle Region)

Produktnummer ABIN631115

Produktdetails anti-Lactate Dehydrogenase C Antikörper

Target: Lactate Dehydrogenase C (LDHC)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Lactate Dehydrogenase C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LDHC antibody was raised against the middle region of LDHC

Aufreinigung: Affinity purified

Immunogen: LDHC antibody was raised using the middle region of LDHC corresponding to a region with amino acids IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LDHC Blocking Peptide, catalog no. 33R-4202, is also available for use as a blocking control in assays to test for specificity of this LDHC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDHC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Lactate Dehydrogenase C

Target: Lactate Dehydrogenase C (LDHC)

Andere Bezeichnung: LDHC (LDHC Produkte)

Synonyme: CT32 antikoerper, LDH3 antikoerper, LDHX antikoerper, LDH-C4 antikoerper, Ldh-3 antikoerper, Ldh-x antikoerper, Ldh3 antikoerper, Ldhc4 antikoerper, LDH-C antikoerper, LDH-X antikoerper, lactate dehydrogenase C antikoerper, L-lactate dehydrogenase C chain antikoerper, LDHC antikoerper, Ldhc antikoerper, ldhc antikoerper, LOC100713414 antikoerper, LOC100343171 antikoerper

Hintergrund: Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Warburg Effekt