beta Actin Antikörper (Middle Region)

Produktnummer ABIN631092

Der Kaninchen Polyklonal anti-beta Actin Antikörper (ABIN631092) detektiert spezifisch beta Actin in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus, Ratte, Hund, Drosophila melanogaster und C. elegans.

Kurzübersicht für beta Actin Antikörper (Middle Region) (ABIN631092)

Target: beta Actin (ACTB) (Actin, beta (ACTB))

Reaktivität: Human, Maus, Ratte, Hund, Drosophila melanogaster, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser beta Actin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-beta Actin Antikörper

Bindungsspezifität: Middle Region

Spezifität: Beta Actin antibody was raised against the middle region of ACTB

Aufreinigung: Affinity purified

Immunogen: beta Actin antibody was raised using the middle region of ACTB corresponding to a region with amino acids TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Beta Actin Blocking Peptide, (ABIN5612316), is also available for use as a blocking control in assays to test for specificity of this Beta Actin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu beta Actin

Target: beta Actin (ACTB) (Actin, beta (ACTB))

Andere Bezeichnung: beta Actin

Hintergrund: This protein is one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Cell-Cell Junction Organization, Maintenance of Protein Location, Phototransduction