ACADL Antikörper (Middle Region)
-
- Target Alle ACADL Antikörper anzeigen
- ACADL (Acyl-CoA Dehydrogenase, Long Chain (ACADL))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACADL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ACADL antibody was raised against the middle region of ACADL
- Aufreinigung
- Affinity purified
- Immunogen
- ACADL antibody was raised using the middle region of ACADL corresponding to a region with amino acids LPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQHKLAEL
- Top Product
- Discover our top product ACADL Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACADL Blocking Peptide, catalog no. 33R-5283, is also available for use as a blocking control in assays to test for specificity of this ACADL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACADL (Acyl-CoA Dehydrogenase, Long Chain (ACADL))
- Andere Bezeichnung
- ACADL (ACADL Produkte)
- Synonyme
- zgc:55656 antikoerper, ACAD4 antikoerper, LCAD antikoerper, ACOADA antikoerper, AA960361 antikoerper, AU018452 antikoerper, C79855 antikoerper, acyl-CoA dehydrogenase long chain antikoerper, acyl-CoA dehydrogenase, long chain antikoerper, acyl-CoA dehydrogenase, long chain L homeolog antikoerper, acyl-Coenzyme A dehydrogenase, long-chain antikoerper, acadl antikoerper, ACADL antikoerper, Acadl antikoerper, acadl.L antikoerper
- Hintergrund
- ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.
- Molekulargewicht
- 44 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-