ACADL Antikörper (Middle Region)

Produktnummer ABIN631083

Dieses Anti-ACADL-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ACADL in WB. Geeignet für Human und Maus.

Kurzübersicht für ACADL Antikörper (Middle Region) (ABIN631083)

Target: ACADL (Acyl-CoA Dehydrogenase, Long Chain (ACADL))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACADL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ACADL Antikörper

Bindungsspezifität: Middle Region

Spezifität: ACADL antibody was raised against the middle region of ACADL

Aufreinigung: Affinity purified

Immunogen: ACADL antibody was raised using the middle region of ACADL corresponding to a region with amino acids LPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQHKLAEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACADL Blocking Peptide, (ABIN5611873), is also available for use as a blocking control in assays to test for specificity of this ACADL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACADL

Target: ACADL (Acyl-CoA Dehydrogenase, Long Chain (ACADL))

Andere Bezeichnung: ACADL

Hintergrund: ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process