ME3 Antikörper
-
- Target Alle ME3 Antikörper anzeigen
- ME3 (Malic Enzyme 3, NADP(+)-Dependent, Mitochondrial (ME3))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ME3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ME3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD
- Top Product
- Discover our top product ME3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ME3 Blocking Peptide, catalog no. 33R-7120, is also available for use as a blocking control in assays to test for specificity of this ME3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ME3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ME3 (Malic Enzyme 3, NADP(+)-Dependent, Mitochondrial (ME3))
- Andere Bezeichnung
- ME3 (ME3 Produkte)
- Synonyme
- NADP-ME antikoerper, 1700020C08Rik antikoerper, B230207H15Rik antikoerper, im:7151680 antikoerper, wu:fi43b04 antikoerper, zgc:163117 antikoerper, malic enzyme 3 antikoerper, malic enzyme 3, NADP(+)-dependent, mitochondrial antikoerper, malic enzyme 3, NADP(+)-dependent, mitochondrial L homeolog antikoerper, NADP malic enzyme 3 antikoerper, ME3 antikoerper, Me3 antikoerper, me3 antikoerper, me3.L antikoerper
- Hintergrund
- Malic enzyme catalyzes the oxidative decarboxylation of malate to pyruvate using either NAD+ or NADP+ as a cofactor. Mammalian tissues contain 3 distinct isoforms of malic enzyme: a cytosolic NADP(+)-dependent isoform, a mitochondrial NADP(+)-dependent isoform, and a mitochondrial NAD(+)-dependent isoform. ME3 is a mitochondrial NADP(+)-dependent isoform.
- Molekulargewicht
- 67 kDa (MW of target protein)
- Pathways
- Warburg Effekt
-