ME3 Antikörper

Produktnummer ABIN631075

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ME3 in WB. Es zeigt Reaktivität gegenüber Proben von Human und Maus.

Kurzübersicht für ME3 Antikörper (ABIN631075)

Target: ME3 (Malic Enzyme 3, NADP(+)-Dependent, Mitochondrial (ME3))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ME3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ME3 Antikörper

Aufreinigung: Affinity purified

Immunogen: ME3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ME3 Blocking Peptide, (ABIN5614717), is also available for use as a blocking control in assays to test for specificity of this ME3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ME3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ME3

Target: ME3 (Malic Enzyme 3, NADP(+)-Dependent, Mitochondrial (ME3))

Andere Bezeichnung: ME3

Hintergrund: Malic enzyme catalyzes the oxidative decarboxylation of malate to pyruvate using either NAD+ or NADP+ as a cofactor. Mammalian tissues contain 3 distinct isoforms of malic enzyme: a cytosolic NADP(+)-dependent isoform, a mitochondrial NADP(+)-dependent isoform, and a mitochondrial NAD(+)-dependent isoform. ME3 is a mitochondrial NADP(+)-dependent isoform.

Molekulargewicht: 67 kDa (MW of target protein)

Pathways: Warburg Effekt