ACAA2 Antikörper (N-Term)

Produktnummer ABIN631066

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ACAA2 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für ACAA2 Antikörper (N-Term) (ABIN631066)

Target: ACAA2 (Acetyl-CoA Acyltransferase 2 (ACAA2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACAA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ACAA2 Antikörper

Bindungsspezifität: N-Term

Spezifität: ACAA2 antibody was raised against the N terminal of ACAA2

Aufreinigung: Affinity purified

Immunogen: ACAA2 antibody was raised using the N terminal of ACAA2 corresponding to a region with amino acids ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACAA2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this ACAA2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAA2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACAA2

Target: ACAA2 (Acetyl-CoA Acyltransferase 2 (ACAA2))

Andere Bezeichnung: ACAA2

Hintergrund: ACAA2 catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process