VPS28 Antikörper

Produktnummer ABIN631062

Der Kaninchen Polyklonal anti-VPS28 Antikörper (ABIN631062) detektiert spezifisch VPS28 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für VPS28 Antikörper (ABIN631062)

Target: VPS28 (Vacuolar Protein Sorting 28 (VPS28))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VPS28 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-VPS28 Antikörper

Aufreinigung: Affinity purified

Immunogen: VPS28 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VPS28 Blocking Peptide, (ABIN5616976), is also available for use as a blocking control in assays to test for specificity of this VPS28 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS28 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VPS28

Target: VPS28 (Vacuolar Protein Sorting 28 (VPS28))

Andere Bezeichnung: VPS28

Hintergrund: This gene encodes a protein involved in endosomal sorting of cell surface receptors via a multivesicular body/late endosome pathway.

Molekulargewicht: 25 kDa (MW of target protein)