ACADS Antikörper (N-Term)

Produktnummer ABIN631058

Der Kaninchen Polyklonal Anti-ACADS-Antikörper wurde für WB validiert. Er ist geeignet, ACADS in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für ACADS Antikörper (N-Term) (ABIN631058)

Target: ACADS (Acads) (Acyl-CoA Dehydrogenase, C-2 To C-3 Short Chain (Acads))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACADS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ACADS Antikörper

Bindungsspezifität: N-Term

Spezifität: ACADS antibody was raised against the N terminal of ACADS

Aufreinigung: Affinity purified

Immunogen: ACADS antibody was raised using the N terminal of ACADS corresponding to a region with amino acids ASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACADS Blocking Peptide, (ABIN936921), is also available for use as a blocking control in assays to test for specificity of this ACADS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACADS

Target: ACADS (Acads) (Acyl-CoA Dehydrogenase, C-2 To C-3 Short Chain (Acads))

Andere Bezeichnung: ACADS

Hintergrund: ACADS is a a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with Short Chain Acyl-CoA Dehydrogenase Deficiency.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process