ACADS Antikörper (N-Term)
-
- Target Alle ACADS (Acads) Antikörper anzeigen
- ACADS (Acads) (Acyl-CoA Dehydrogenase, C-2 To C-3 Short Chain (Acads))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACADS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ACADS antibody was raised against the N terminal of ACADS
- Aufreinigung
- Affinity purified
- Immunogen
- ACADS antibody was raised using the N terminal of ACADS corresponding to a region with amino acids ASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGN
- Top Product
- Discover our top product Acads Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACADS Blocking Peptide, catalog no. 33R-1535, is also available for use as a blocking control in assays to test for specificity of this ACADS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACADS (Acads) (Acyl-CoA Dehydrogenase, C-2 To C-3 Short Chain (Acads))
- Andere Bezeichnung
- ACADS (Acads Produkte)
- Hintergrund
- ACADS is a a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with Short Chain Acyl-CoA Dehydrogenase Deficiency.
- Molekulargewicht
- 42 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-