ALAS2 Antikörper (C-Term)
Kurzübersicht für ALAS2 Antikörper (C-Term) (ABIN631026)
Target
Alle ALAS2 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- C-Term
-
Spezifität
- ALAS2 antibody was raised against the C terminal of ALAS2
-
Aufreinigung
- Affinity purified
-
Immunogen
- ALAS2 antibody was raised using the C terminal of ALAS2 corresponding to a region with amino acids VRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRVGNAA
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
ALAS2 Blocking Peptide, (ABIN5612005), is also available for use as a blocking control in assays to test for specificity of this ALAS2 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALAS2 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- ALAS2 (Aminolevulinate, delta-, Synthase 2 (ALAS2))
-
Andere Bezeichnung
- ALAS2
-
Hintergrund
- ALAS2 specifies an erythroid-specific mitochondrially located enzyme. It catalyzes the first step in the heme biosynthetic pathway. Defects in this gene cause X-linked pyridoxine-responsive sideroblastic anemia.
-
Molekulargewicht
- 60 kDa (MW of target protein)
-
Pathways
- Transition Metal Ion Homeostasis
Target
-