DLD Antikörper (Middle Region)

Produktnummer ABIN631024

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch DLD in WB. Es zeigt Reaktivität gegenüber Proben von Human und Hund.

Kurzübersicht für DLD Antikörper (Middle Region) (ABIN631024)

Target: DLD (Dihydrolipoamide Dehydrogenase (DLD))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DLD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DLD Antikörper

Bindungsspezifität: Middle Region

Spezifität: DLD antibody was raised against the middle region of DLD

Aufreinigung: Affinity purified

Immunogen: DLD antibody was raised using the middle region of DLD corresponding to a region with amino acids AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DLD Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this DLD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DLD

Target: DLD (Dihydrolipoamide Dehydrogenase (DLD))

Andere Bezeichnung: DLD

Hintergrund: DLD is the L protein of the mitochondrial glycine cleavage system. The L protein, also named dihydrolipoamide dehydrogenase, is also a component of the pyruvate dehydrogenase complex, the alpha-ketoglutarate dehydrogenase complex, and the branched-chain alpha-keto acide dehydrogenase complex. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Cell RedoxHomeostasis