ACO2 Antikörper (Middle Region)
-
- Target Alle ACO2 Antikörper anzeigen
- ACO2 (Aconitase 2, Mitochondrial (ACO2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus, C. elegans
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACO2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ACO2 antibody was raised against the middle region of ACO2
- Aufreinigung
- Affinity purified
- Immunogen
- ACO2 antibody was raised using the middle region of ACO2 corresponding to a region with amino acids RYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHET
- Top Product
- Discover our top product ACO2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACO2 Blocking Peptide, catalog no. 33R-8284, is also available for use as a blocking control in assays to test for specificity of this ACO2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACO2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACO2 (Aconitase 2, Mitochondrial (ACO2))
- Andere Bezeichnung
- ACO2 (ACO2 Produkte)
- Synonyme
- DDBDRAFT_0206187 antikoerper, DDBDRAFT_0230168 antikoerper, DDB_0206187 antikoerper, DDB_0230168 antikoerper, aconitase 2 antikoerper, F10M23.310 antikoerper, F10M23_310 antikoerper, ACONM antikoerper, ICRD antikoerper, Aco-2 antikoerper, Aco3 antikoerper, D10Wsu183e antikoerper, cb1017 antikoerper, wu:fa10e03 antikoerper, wu:fb69g04 antikoerper, wu:fc20c11 antikoerper, aconitase 2 antikoerper, aconitase 2 S homeolog antikoerper, aconitate hydratase, mitochondrial antikoerper, aconitase, mitochondrial antikoerper, mitochondrial aconitate hydratase antikoerper, aconitase 2, mitochondrial antikoerper, Probable aconitate hydratase, mitochondrial antikoerper, ACO2 antikoerper, aco2.S antikoerper, Bm1_07420 antikoerper, aco2 antikoerper, ach1 antikoerper, Aco2 antikoerper, aco-2 antikoerper
- Hintergrund
- ACO2 belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.
- Molekulargewicht
- 82 kDa (MW of target protein)
-