ACO2 Antikörper (N-Term)

Produktnummer ABIN631018

Produktdetails anti-ACO2 Antikörper

Target: ACO2 (Aconitase 2, Mitochondrial (ACO2))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACO2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACO2 antibody was raised against the N terminal of ACO2

Aufreinigung: Affinity purified

Immunogen: ACO2 antibody was raised using the N terminal of ACO2 corresponding to a region with amino acids LQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACO2 Blocking Peptide, catalog no. 33R-5311, is also available for use as a blocking control in assays to test for specificity of this ACO2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACO2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACO2

Target: ACO2 (Aconitase 2, Mitochondrial (ACO2))

Andere Bezeichnung: ACO2 (ACO2 Produkte)

Synonyme: DDBDRAFT_0206187 antikoerper, DDBDRAFT_0230168 antikoerper, DDB_0206187 antikoerper, DDB_0230168 antikoerper, aconitase 2 antikoerper, F10M23.310 antikoerper, F10M23_310 antikoerper, ACONM antikoerper, ICRD antikoerper, Aco-2 antikoerper, Aco3 antikoerper, D10Wsu183e antikoerper, cb1017 antikoerper, wu:fa10e03 antikoerper, wu:fb69g04 antikoerper, wu:fc20c11 antikoerper, aconitase 2 antikoerper, aconitase 2 S homeolog antikoerper, aconitate hydratase, mitochondrial antikoerper, aconitase, mitochondrial antikoerper, mitochondrial aconitate hydratase antikoerper, aconitase 2, mitochondrial antikoerper, Probable aconitate hydratase, mitochondrial antikoerper, ACO2 antikoerper, aco2.S antikoerper, Bm1_07420 antikoerper, aco2 antikoerper, ach1 antikoerper, Aco2 antikoerper, aco-2 antikoerper

Hintergrund: ACO2 belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.

Molekulargewicht: 82 kDa (MW of target protein)