Prohibitin 2 Antikörper (N-Term)
-
- Target Alle Prohibitin 2 (PHB2) Antikörper anzeigen
- Prohibitin 2 (PHB2)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Prohibitin 2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Prohibitin 2 antibody was raised against the N terminal of PHB2
- Aufreinigung
- Affinity purified
- Immunogen
- Prohibitin 2 antibody was raised using the N terminal of PHB2 corresponding to a region with amino acids WFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQR
- Top Product
- Discover our top product PHB2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Prohibitin 2 Blocking Peptide, catalog no. 33R-9946, is also available for use as a blocking control in assays to test for specificity of this Prohibitin 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHB2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Prohibitin 2 (PHB2)
- Andere Bezeichnung
- Prohibitin 2 (PHB2 Produkte)
- Synonyme
- bcap37 antikoerper, zgc:73150 antikoerper, wu:fc28c08 antikoerper, PHB2 antikoerper, phb2 antikoerper, ATPHB2 antikoerper, F21M11.21 antikoerper, F21M11_21 antikoerper, prohibitin 2 antikoerper, DKFZp469N1310 antikoerper, BAP antikoerper, BCAP37 antikoerper, Bap37 antikoerper, PNAS-141 antikoerper, REA antikoerper, p22 antikoerper, bap37 antikoerper, prohibitin2 antikoerper, xphb2 antikoerper, AU044498 antikoerper, Bcap37 antikoerper, Bap antikoerper, Bap-37 antikoerper, Bcap27 antikoerper, prohibitin 2a antikoerper, prohibitin 2 antikoerper, prohibitin 2 S homeolog antikoerper, phb2a antikoerper, PHB2 antikoerper, phb2 antikoerper, phb2.S antikoerper, Phb2 antikoerper
- Hintergrund
- PHB2 acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases (By similarity). It functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. PHB2 competes with NCOA1 for modulation of ER transcriptional activity. It probably involved in regulating mitochondrial respiration activity and in aging.
- Molekulargewicht
- 33 kDa (MW of target protein)
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling
-