GRPEL2 Antikörper

Produktnummer ABIN630999

Produktdetails anti-GRPEL2 Antikörper

Target: GRPEL2 (GrpE-Like 2, Mitochondrial (GRPEL2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GRPEL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GRPEL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GRPEL2 Blocking Peptide, catalog no. 33R-3717, is also available for use as a blocking control in assays to test for specificity of this GRPEL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRPEL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GRPEL2

Target: GRPEL2 (GrpE-Like 2, Mitochondrial (GRPEL2))

Andere Bezeichnung: GRPEL2 (GRPEL2 Produkte)

Synonyme: mt-GrpE2 antikoerper, mt-Grpel2 antikoerper, Afap1l1 antikoerper, Mt-GrpE2 antikoerper, GrpE-like 2, mitochondrial antikoerper, GrpE like 2, mitochondrial antikoerper, Grpel2 antikoerper, GRPEL2 antikoerper

Hintergrund: GRPEL2 is an essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. GRPEL2 seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. GRPEL2 stimulates ATPase activity of mt-HSP70. GRPEL2 may also serve to modulate the interconversion of oligomeric (inactive) and monomeric (active) forms of mt-HSP70.

Molekulargewicht: 25 kDa (MW of target protein)