Prohibitin 2 Antikörper (C-Term)
-
- Target Alle Prohibitin 2 (PHB2) Antikörper anzeigen
- Prohibitin 2 (PHB2)
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Prohibitin 2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Prohibitin 2 antibody was raised against the C terminal of PHB2
- Aufreinigung
- Affinity purified
- Immunogen
- Prohibitin 2 antibody was raised using the C terminal of PHB2 corresponding to a region with amino acids KLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
- Top Product
- Discover our top product PHB2 Primärantikörper
-
anti-Prohibitin 2 (PHB2) antibody
PHB2 Reaktivität: Human WB, IHC (p), IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Prohibitin 2 (PHB2) antibodyPHB2 Reaktivität: Human WB, IHC, IP, IF Wirt: Kaninchen Monoclonal unconjugated
anti-Prohibitin 2 (PHB2) (AA 225-255) antibodyPHB2 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB15576 unconjugated
anti-Prohibitin 2 (PHB2) (C-Term) antibodyPHB2 Reaktivität: Human, Maus, Ratte, Kaninchen, Meerschweinchen, Rind (Kuh), Hund, Schwein WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Prohibitin 2 (PHB2) (Middle Region) antibodyPHB2 Reaktivität: Human, Maus, Ratte WB, IHC (p), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Prohibitin 2 (PHB2) (AA 1-299) antibodyPHB2 Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Prohibitin 2 (PHB2) (AA 197-226), (C-Term) antibodyPHB2 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB10631 unconjugated
anti-Prohibitin 2 (PHB2) (AA 106-134) antibodyPHB2 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB15314 unconjugated
anti-Prohibitin 2 (PHB2) (AA 1-299) antibodyPHB2 Reaktivität: Human WB, IHC, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Prohibitin 2 (PHB2) (Tyr128) antibodyPHB2 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Prohibitin 2 Blocking Peptide, catalog no. 33R-4533, is also available for use as a blocking control in assays to test for specificity of this Prohibitin 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHB2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Prohibitin 2 (PHB2)
- Andere Bezeichnung
- Prohibitin 2 (PHB2 Produkte)
- Hintergrund
- PHB2 acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases (By similarity). It functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. PHB2 competes with NCOA1 for modulation of ER transcriptional activity. It probably involved in regulating mitochondrial respiration activity and in aging.
- Molekulargewicht
- 33 kDa (MW of target protein)
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling
-
