Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

Prohibitin 2 Antikörper (C-Term)

Dieses Anti-Prohibitin 2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Prohibitin 2 in WB. Geeignet für Human, Maus und Ratte.
Produktnummer ABIN630990

Kurzübersicht für Prohibitin 2 Antikörper (C-Term) (ABIN630990)

Target

Alle Prohibitin 2 (PHB2) Antikörper anzeigen
Prohibitin 2 (PHB2)

Reaktivität

  • 80
  • 40
  • 17
  • 11
  • 8
  • 8
  • 7
  • 5
  • 3
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
Human, Maus, Ratte

Wirt

  • 78
  • 3
  • 2
Kaninchen

Klonalität

  • 77
  • 6
Polyklonal

Konjugat

  • 53
  • 4
  • 4
  • 4
  • 3
  • 3
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Dieser Prohibitin 2 Antikörper ist unkonjugiert

Applikation

  • 71
  • 30
  • 25
  • 20
  • 16
  • 13
  • 13
  • 12
  • 11
  • 10
  • 5
  • 3
  • 2
  • 2
  • 1
  • 1
Western Blotting (WB)
  • Bindungsspezifität

    • 16
    • 11
    • 8
    • 8
    • 6
    • 5
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    C-Term

    Spezifität

    Prohibitin 2 antibody was raised against the C terminal of PHB2

    Aufreinigung

    Affinity purified

    Immunogen

    Prohibitin 2 antibody was raised using the C terminal of PHB2 corresponding to a region with amino acids KLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
  • Applikationshinweise

    WB: 0.5 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    Prohibitin 2 Blocking Peptide, (ABIN939919), is also available for use as a blocking control in assays to test for specificity of this Prohibitin 2 antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHB2 antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    Prohibitin 2 (PHB2)

    Andere Bezeichnung

    Prohibitin 2

    Hintergrund

    PHB2 acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases (By similarity). It functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. PHB2 competes with NCOA1 for modulation of ER transcriptional activity. It probably involved in regulating mitochondrial respiration activity and in aging.

    Molekulargewicht

    33 kDa (MW of target protein)

    Pathways

    Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling
Sie sind hier:
Chat with us!