PDE1C Antikörper (N-Term)

Produktnummer ABIN630963

Der Kaninchen Polyklonal anti-PDE1C Antikörper (ABIN630963) detektiert spezifisch PDE1C in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für PDE1C Antikörper (N-Term) (ABIN630963)

Target: PDE1C (phosphodiesterase 1C, Calmodulin-Dependent 70kDa (PDE1C))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDE1C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PDE1C Antikörper

Bindungsspezifität: N-Term

Spezifität: PDE1 C antibody was raised against the N terminal of PDE1

Aufreinigung: Affinity purified

Immunogen: PDE1 C antibody was raised using the N terminal of PDE1 corresponding to a region with amino acids DLKKNIEYAASVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLAST

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDE1C Blocking Peptide, (ABIN937437), is also available for use as a blocking control in assays to test for specificity of this PDE1C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDE1C

Target: PDE1C (phosphodiesterase 1C, Calmodulin-Dependent 70kDa (PDE1C))

Andere Bezeichnung: PDE1C

Hintergrund: PDE1A belongs to the cyclic nucleotide phosphodiesterase family. It has a higher affinity for cGMP than for cAMP. The exact function of PDE1A remains unknown.

Molekulargewicht: 59 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Neurotrophin Signalübertragung, Negative Regulation of Hormone Secretion, cAMP Metabolic Process, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma