PDE1C Antikörper (N-Term)
Kurzübersicht für PDE1C Antikörper (N-Term) (ABIN630963)
Target
Alle PDE1C Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- PDE1 C antibody was raised against the N terminal of PDE1
-
Aufreinigung
- Affinity purified
-
Immunogen
- PDE1 C antibody was raised using the N terminal of PDE1 corresponding to a region with amino acids DLKKNIEYAASVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLAST
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
PDE1C Blocking Peptide, (ABIN937437), is also available for use as a blocking control in assays to test for specificity of this PDE1C antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- PDE1C (phosphodiesterase 1C, Calmodulin-Dependent 70kDa (PDE1C))
-
Andere Bezeichnung
- PDE1C
-
Hintergrund
- PDE1A belongs to the cyclic nucleotide phosphodiesterase family. It has a higher affinity for cGMP than for cAMP. The exact function of PDE1A remains unknown.
-
Molekulargewicht
- 59 kDa (MW of target protein)
-
Pathways
- EGFR Signaling Pathway, Neurotrophin Signalübertragung, Negative Regulation of Hormone Secretion, cAMP Metabolic Process, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma
Target
-