SPAG8 Antikörper (Middle Region)

Produktnummer ABIN630959

Der Kaninchen Polyklonal Anti-SPAG8-Antikörper wurde für WB validiert. Er ist geeignet, SPAG8 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für SPAG8 Antikörper (Middle Region) (ABIN630959)

Target: SPAG8 (Sperm Associated Antigen 8 (SPAG8))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPAG8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SPAG8 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SPAG8 antibody was raised against the middle region of SPAG8

Aufreinigung: Affinity purified

Immunogen: SPAG8 antibody was raised using the middle region of SPAG8 corresponding to a region with amino acids PAPTKPHDYRQEQPETFWIQRAPQLPTWWPLPTQVPAAEDYLTWKEWGFT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SPAG8 Blocking Peptide, (ABIN5616355), is also available for use as a blocking control in assays to test for specificity of this SPAG8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPAG8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SPAG8

Target: SPAG8 (Sperm Associated Antigen 8 (SPAG8))

Andere Bezeichnung: SPAG8

Hintergrund: The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. SPAG8 is recognised by sperm agglutinating antibodies from an infertile woman. This protein is localized in germ cells of the testis at all stages of spermatogenesis and is localized to the acrosomal region of mature spermatozoa.

Molekulargewicht: 53 kDa (MW of target protein)