PTGDS Antikörper (N-Term)

Produktnummer ABIN630956

Der Kaninchen Polyklonal Anti-PTGDS-Antikörper wurde für WB validiert. Er ist geeignet, PTGDS in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für PTGDS Antikörper (N-Term) (ABIN630956)

Target: PTGDS (Prostaglandin D2 Synthase (PTGDS))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTGDS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PTGDS Antikörper

Bindungsspezifität: N-Term

Spezifität: PGDS antibody was raised against the N terminal of PGDS

Aufreinigung: Affinity purified

Immunogen: PGDS antibody was raised using the N terminal of PGDS corresponding to a region with amino acids EQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEME

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PGDS Blocking Peptide, (ABIN938043), is also available for use as a blocking control in assays to test for specificity of this PGDS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGDS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PTGDS

Target: PTGDS (Prostaglandin D2 Synthase (PTGDS))

Andere Bezeichnung: PGDS

Hintergrund: PGDS is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes.

Molekulargewicht: 23 kDa (MW of target protein)