LOC645015 (Middle Region) Antikörper

Produktnummer ABIN630945

Dieses Anti--Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von in WB. Geeignet für Human.

Kurzübersicht für LOC645015 (Middle Region) Antikörper (ABIN630945)

Target: LOC645015

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Bindungsspezifität: Middle Region

Spezifität: LOC645015 antibody was raised against the middle region of LOC645015

Aufreinigung: Affinity purified

Immunogen: LOC645015 antibody was raised using the middle region of LOC645015 corresponding to a region with amino acids LPSLVCVITGQGPLTEYYSRPIHQKHFQHIQVCNPWLEAEDYPLLLGSVD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LOC645015 Blocking Peptide, (ABIN5614525), is also available for use as a blocking control in assays to test for specificity of this LOC645015 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC645015 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: LOC645015

Hintergrund: The function of LOC645015 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 35 kDa (MW of target protein)