PPP2R3A Antikörper

Produktnummer ABIN630911

Der Kaninchen Polyklonal anti-PPP2R3A Antikörper wird verwendet zum Nachweis von PPP2R3A in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für PPP2R3A Antikörper (ABIN630911)

Target: PPP2R3A (Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPP2R3A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PPP2R3A Antikörper

Aufreinigung: Affinity purified

Immunogen: PPP2 R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPP2R3A Blocking Peptide, (ABIN5615519), is also available for use as a blocking control in assays to test for specificity of this PPP2R3A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPP2R3A

Target: PPP2R3A (Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A))

Andere Bezeichnung: PPP2R3A

Hintergrund: Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division.

Molekulargewicht: 130 kDa (MW of target protein)

Pathways: PI3K-Akt Signalweg