PPP2R3A Antikörper

Produktnummer ABIN630911

Produktdetails anti-PPP2R3A Antikörper

Target: PPP2R3A (Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPP2R3A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PPP2 R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPP2R3A Blocking Peptide, catalog no. 33R-8853, is also available for use as a blocking control in assays to test for specificity of this PPP2R3A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPP2R3A

Target: PPP2R3A (Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A))

Andere Bezeichnung: PPP2R3A (PPP2R3A Produkte)

Synonyme: PPP2R3 antikoerper, PR130 antikoerper, PR72 antikoerper, 3222402P14Rik antikoerper, A730042E07 antikoerper, PPP2R3A antikoerper, Ppp2r3a antikoerper, protein phosphatase 2 regulatory subunit B''alpha antikoerper, protein phosphatase 2, regulatory subunit B'', alpha antikoerper, protein phosphatase 2 regulatory subunit B, alpha S homeolog antikoerper, serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha antikoerper, PPP2R3A antikoerper, Ppp2r3a antikoerper, ppp2r3a.S antikoerper, LOC100088744 antikoerper, LOC100478108 antikoerper, ppp2r3a antikoerper, LOC100547843 antikoerper, LOC100729010 antikoerper

Hintergrund: Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division.

Molekulargewicht: 130 kDa (MW of target protein)

Pathways: PI3K-Akt Signalweg