HSPB8 Antikörper (N-Term)

Produktnummer ABIN630901

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch HSPB8 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für HSPB8 Antikörper (N-Term) (ABIN630901)

Target: HSPB8 (Heat Shock 22kDa Protein 8 (HSPB8))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HSPB8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HSPB8 Antikörper

Bindungsspezifität: N-Term

Spezifität: HSPB8 antibody was raised against the N terminal of HSPB8

Aufreinigung: Affinity purified

Immunogen: HSPB8 antibody was raised using the N terminal of HSPB8 corresponding to a region with amino acids ADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HSPB8 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this HSPB8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPB8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HSPB8

Target: HSPB8 (Heat Shock 22kDa Protein 8 (HSPB8))

Andere Bezeichnung: HSPB8

Hintergrund: HSPB8 belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of HSPB8 protein is induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, HSPB8 appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in the encoding HSPB8 gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease.

Molekulargewicht: 21 kDa (MW of target protein)